CESENGLISH STUDY
내 단어 (0)
CES 영어사전

Chiplike

발음 발음 정보 없음 · 품사 형용사 (adjective)

가장 먼저 보는 뜻

한국어 뜻

검증된 한국어 뜻을 준비 중입니다. 확인되지 않은 자동 번역은 표시하지 않습니다.

영어 정의

Resembling or characteristic of a chip (fragment of stone etc.)..

의미별 영어 정의

  1. Resembling or characteristic of a chip (fragment of stone etc.).
  2. Resembling or characteristic of a chip (damaged area of a surface where a small piece has broken off).
  3. (US) Resembling or characteristic of a chip (thin, crisp, baked piece of vegetable).
  4. (UK, Australia, New Zealand) Resembling or characteristic of a chip (wedge of fried potato).
  5. Resembling or characteristic of a chip (electronic circuit fabricated on substrate).

예문

The plaster itself was light gray in color and contained small, broken, or chiplike stones...
The Morgana girls pulled the orphans′ hands and dragged them in, or pushed suddenly from behind, and finally the orphans took hold of one another and waded forward in a body, singing “Good Morning” with their stiff, chiplike lips.
Scratches, Nicks and Snags (Figs 2.26, 2.35, 2.36). Angular tears, notches, or chiplike injuries in the surface of the rubber caused by sharp objects such as wire, pointed tools, staples. or other similar sharp-edged hazards.
Psyllie Snacks: I know these sound strange, but this chiplike snack made from psyllium fiber—the same fiber used in Metamucil—is remarkably good. Remember that they′re fiber, and go easy!
[…]which broke whatever final layer of ice needed melting with these two strangers in front of us, their eyebrows pierced and their fingertips stained orange from some triangular chiplike snack they were sharing.
Puri is a soft, puffy bread, and papadam is round, crispy, and chiplike.
...the chemical structure required for the generation of chiplike flavor during deep fat frying of methionine is specific.
Workers have begun to grow cultured neurons on chiplike matrix structures.

단어 변화형

관련 단어

chipmunklikechisellikechippyshardlikechipmunkychunklikesplinterlikepebblelikechimplikefish-and-chippyflakelikechimelikechoplikechasmlikeshrimpychimpychitinlikesliverlikescablikeplaquelike

Chiplike 사용 팁

chiplike의 의미, 어조와 문법이 전체 문장에 맞을 때 사용하세요. 동의어라도 모든 문장에서 바로 바꿔 쓸 수 있는 것은 아닙니다.

이 단어 복습하기

내 단어 목록 열기관련 단어로 퍼즐 만들기동의어와 반의어문맥별 Better Word

자주 묻는 질문

chiplike의 뜻은 무엇인가요?

현재 검증된 한국어 뜻은 준비 중이며 영어 정의는 “Resembling or characteristic of a chip (fragment of stone etc.).”입니다.

chiplike의 동의어는 무엇인가요?

문장 속 의미에 따라 가까운 동의어가 달라집니다.

chiplike의 반의어는 무엇인가요?

정확한 반대말은 사용된 의미에 따라 달라집니다.

chiplike를 문장에서 어떻게 쓰나요?

The plaster itself was light gray in color and contained small, broken, or chiplike stones...

영어사전 출처

FreeDictionaryAPI.com / Wiktionary · 원문 출처 · CC BY-SA 4.0

영어사전 정보는 FreeDictionaryAPI.com이 제공하며 해당 서비스가 밝힌 Wiktionary 라이선스를 따릅니다.