CESENGLISH STUDY
내 단어 (0)
CES 영어사전

Mesa

발음 /ˈmeɪ.sə/ · 품사 명사 (noun)

가장 먼저 보는 뜻

한국어 뜻

검증된 한국어 뜻을 준비 중입니다. 확인되지 않은 자동 번역은 표시하지 않습니다.

영어 정의

A flat area of land or plateau higher than other land, with one or more clifflike edges..

의미별 영어 정의

  1. A flat area of land or plateau higher than other land, with one or more clifflike edges.
  2. (electronics) a structure with components rising above the insulating substrate that surrounds it

예문

A few more miles of hot sand and gravel and red stone brought us around a low mesa to the Little Colorado River.
Low mesas, dry, treeless, stretch back from the brink of the canyon, often showing smooth surfaces of naked, solid rock.
Those multitoned buttes and mesas [of the Grand Canyon], and that incandescent sequence of colorful bands that make one of the natural wonders of the world so grand, can also be found over 100 million miles away [on Mars].
The ohmic contacts were deposited at the edge of the mesa.

단어 변화형

mesa 동의어

table

관련 단어

tabletablelandplateaupanelcartoucheshelftraydeskplattermeatmassoverlookbureauwastelosecommitteefailmissanimeza

Mesa 사용 팁

mesa의 의미, 어조와 문법이 전체 문장에 맞을 때 사용하세요. 동의어라도 모든 문장에서 바로 바꿔 쓸 수 있는 것은 아닙니다.

이 단어 복습하기

내 단어 목록 열기관련 단어로 퍼즐 만들기동의어와 반의어문맥별 Better Word

자주 묻는 질문

mesa의 뜻은 무엇인가요?

현재 검증된 한국어 뜻은 준비 중이며 영어 정의는 “A flat area of land or plateau higher than other land, with one or more clifflike edges.”입니다.

mesa의 동의어는 무엇인가요?

주요 동의어는 table입니다.

mesa의 반의어는 무엇인가요?

정확한 반대말은 사용된 의미에 따라 달라집니다.

mesa를 문장에서 어떻게 쓰나요?

A few more miles of hot sand and gravel and red stone brought us around a low mesa to the Little Colorado River.

영어사전 출처

FreeDictionaryAPI.com / Wiktionary · 원문 출처 · CC BY-SA 4.0

영어사전 정보는 FreeDictionaryAPI.com이 제공하며 해당 서비스가 밝힌 Wiktionary 라이선스를 따릅니다.