CESENGLISH STUDY
내 단어 (0)
CES 영어사전

Smiley

발음 /ˈsmaɪli/ · 품사 형용사 (adjective)

가장 먼저 보는 뜻

한국어 뜻

검증된 한국어 뜻을 준비 중입니다. 확인되지 않은 자동 번역은 표시하지 않습니다.

영어 정의

Cheerful and happy; smiling..

의미별 영어 정의

  1. Cheerful and happy; smiling.
  2. (slang) Having one's throat slit from side to side.
  3. A simplified representation of a smiling face.
  4. (Internet) A sequence of text characters used to represent a mood, especially :) or :-) or other depictions of smiling.
  5. (rare) An improvised street weapon consisting of a length of chain with padlocks and other heavy objects affixed to one end.
  6. (South Africa) A roasted sheep's head.
  7. A piercing worn in the upper frenulum (upper lip).

예문

have a smiley demeanor
a very smiley girl
How do you type the angry smiley?
Smiley/Scrumper and Frowny Smiley and scrumper are both names for a piercing of the upper frenulum that attaches the center of the lip to the gums.

단어 변화형

smiley 동의어

smiley faceemoticon

관련 단어

merrycheerfulhappyexpensivefacesidecara-happysidedsmilybeamingsmilefulcheerygood-humoredbrightsmilishsmiles and gigglylightchippersunny

Smiley 사용 팁

smiley의 의미, 어조와 문법이 전체 문장에 맞을 때 사용하세요. 동의어라도 모든 문장에서 바로 바꿔 쓸 수 있는 것은 아닙니다.

이 단어 복습하기

내 단어 목록 열기관련 단어로 퍼즐 만들기동의어와 반의어문맥별 Better Word

자주 묻는 질문

smiley의 뜻은 무엇인가요?

현재 검증된 한국어 뜻은 준비 중이며 영어 정의는 “Cheerful and happy; smiling.”입니다.

smiley의 동의어는 무엇인가요?

주요 동의어는 smiley face, emoticon입니다.

smiley의 반의어는 무엇인가요?

정확한 반대말은 사용된 의미에 따라 달라집니다.

smiley를 문장에서 어떻게 쓰나요?

have a smiley demeanor

영어사전 출처

FreeDictionaryAPI.com / Wiktionary · 원문 출처 · CC BY-SA 4.0

영어사전 정보는 FreeDictionaryAPI.com이 제공하며 해당 서비스가 밝힌 Wiktionary 라이선스를 따릅니다.